SNRPA1,Lea1
  • SNRPA1,Lea1

Anti-SNRPA1 Antibody 100ul

Ref: AN-HPA045622-100ul
Anti-SNRPA1

Información del producto

Polyclonal Antibody against Human SNRPA1, Gene description: small nuclear ribonucleoprotein polypeptide A', Alternative Gene Names: Lea1, Validated applications: ICC, IHC, WB, Uniprot ID: P09661, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNRPA1
Gene Description small nuclear ribonucleoprotein polypeptide A'
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP
Immunogen VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Lea1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09661
HTS Code 3002150000
Gene ID 6627
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNRPA1 Antibody 100ul

Anti-SNRPA1 Antibody 100ul