OR8S1
  • OR8S1

Anti-OR8S1 Antibody 100ul

Ref: AN-HPA045595-100ul
Anti-OR8S1

Información del producto

Polyclonal Antibody against Human OR8S1, Gene description: olfactory receptor, family 8, subfamily S, member 1, Validated applications: ICC, IHC, Uniprot ID: Q8NH09, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OR8S1
Gene Description olfactory receptor, family 8, subfamily S, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP
Immunogen ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NH09
HTS Code 3002150000
Gene ID 341568
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OR8S1 Antibody 100ul

Anti-OR8S1 Antibody 100ul