MCRIP1,FAM195B
  • MCRIP1,FAM195B

Anti-MCRIP1 Antibody 100ul

Ref: AN-HPA045542-100ul
Anti-MCRIP1

Información del producto

Polyclonal Antibody against Human MCRIP1, Gene description: MAPK regulated corepressor interacting protein 1, Alternative Gene Names: FAM195B, GRAN2, MCRIP, Validated applications: IHC, Uniprot ID: C9JLW8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MCRIP1
Gene Description MAPK regulated corepressor interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS
Immunogen VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM195B, GRAN2, MCRIP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID C9JLW8
HTS Code 3002150000
Gene ID 348262
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MCRIP1 Antibody 100ul

Anti-MCRIP1 Antibody 100ul