EIF4EBP3,4E-BP3
  • EIF4EBP3,4E-BP3

Anti-EIF4EBP3 Antibody 100ul

Ref: AN-HPA045537-100ul
Anti-EIF4EBP3

Información del producto

Polyclonal Antibody against Human EIF4EBP3, Gene description: eukaryotic translation initiation factor 4E binding protein 3, Alternative Gene Names: 4E-BP3, Validated applications: IHC, Uniprot ID: O60516, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EIF4EBP3
Gene Description eukaryotic translation initiation factor 4E binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM
Immunogen LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4E-BP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60516
HTS Code 3002150000
Gene ID 8637
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF4EBP3 Antibody 100ul

Anti-EIF4EBP3 Antibody 100ul