EPYC,DSPG3,Pg-Lb
  • EPYC,DSPG3,Pg-Lb

Anti-EPYC Antibody 100ul

Ref: AN-HPA045455-100ul
Anti-EPYC

Información del producto

Polyclonal Antibody against Human EPYC, Gene description: epiphycan, Alternative Gene Names: DSPG3, Pg-Lb, SLRR3B, Validated applications: IHC, Uniprot ID: Q99645, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EPYC
Gene Description epiphycan
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEE
Immunogen PTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DSPG3, Pg-Lb, SLRR3B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99645
HTS Code 3002150000
Gene ID 1833
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EPYC Antibody 100ul

Anti-EPYC Antibody 100ul