FSTL3,FLRG,FSRP
  • FSTL3,FLRG,FSRP

Anti-FSTL3 Antibody 25ul

Ref: AN-HPA045378-25ul
Anti-FSTL3

Información del producto

Polyclonal Antibody against Human FSTL3, Gene description: follistatin-like 3 (secreted glycoprotein), Alternative Gene Names: FLRG, FSRP, Validated applications: ICC, IHC, Uniprot ID: O95633, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FSTL3
Gene Description follistatin-like 3 (secreted glycoprotein)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG
Immunogen MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLRG, FSRP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95633
HTS Code 3002150000
Gene ID 10272
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FSTL3 Antibody 25ul

Anti-FSTL3 Antibody 25ul