DEFB104A,DEFB-4
  • DEFB104A,DEFB-4

Anti-DEFB104A Antibody 25ul

Ref: AN-HPA045292-25ul
Anti-DEFB104A

Información del producto

Polyclonal Antibody against Human DEFB104A, Gene description: defensin, beta 104A, Alternative Gene Names: DEFB-4, DEFB104, DEFB4, Validated applications: IHC, Uniprot ID: Q8WTQ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DEFB104A
Gene Description defensin, beta 104A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
Immunogen EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEFB-4, DEFB104, DEFB4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WTQ1
HTS Code 3002150000
Gene ID 140596
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DEFB104A Antibody 25ul

Anti-DEFB104A Antibody 25ul