WASF2,SCAR2,WAVE2
  • WASF2,SCAR2,WAVE2

Anti-WASF2 Antibody 100ul

Ref: AN-HPA045288-100ul
Anti-WASF2

Información del producto

Polyclonal Antibody against Human WASF2, Gene description: WAS protein family, member 2, Alternative Gene Names: SCAR2, WAVE2, Validated applications: ICC, IHC, Uniprot ID: Q9Y6W5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WASF2
Gene Description WAS protein family, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP
Immunogen DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SCAR2, WAVE2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6W5
HTS Code 3002150000
Gene ID 10163
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WASF2 Antibody 100ul

Anti-WASF2 Antibody 100ul