CYP2D6,CPD6,CYP2D
  • CYP2D6,CPD6,CYP2D

Anti-CYP2D6 Antibody 25ul

Ref: AN-HPA045223-25ul
Anti-CYP2D6

Información del producto

Polyclonal Antibody against Human CYP2D6, Gene description: cytochrome P450, family 2, subfamily D, polypeptide 6, Alternative Gene Names: CPD6, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, P450-DB1, P450C2D, Validated applications: IHC, WB, Uniprot ID: P10635, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYP2D6
Gene Description cytochrome P450, family 2, subfamily D, polypeptide 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
Immunogen EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPD6, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, P450-DB1, P450C2D
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P10635
HTS Code 3002150000
Gene ID 1565
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CYP2D6 Antibody 25ul

Anti-CYP2D6 Antibody 25ul