KIF23,KNSL5,MKLP-1
  • KIF23,KNSL5,MKLP-1

Anti-KIF23 Antibody 25ul

Ref: AN-HPA045208-25ul
Anti-KIF23

Información del producto

Polyclonal Antibody against Human KIF23, Gene description: kinesin family member 23, Alternative Gene Names: KNSL5, MKLP-1, MKLP1, Validated applications: ICC, Uniprot ID: Q02241, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KIF23
Gene Description kinesin family member 23
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLN
Immunogen FDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KNSL5, MKLP-1, MKLP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q02241
HTS Code 3002150000
Gene ID 9493
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KIF23 Antibody 25ul

Anti-KIF23 Antibody 25ul