ZMIZ1,FLJ13541
  • ZMIZ1,FLJ13541

Anti-ZMIZ1 Antibody 25ul

Ref: AN-HPA045144-25ul
Anti-ZMIZ1

Información del producto

Polyclonal Antibody against Human ZMIZ1, Gene description: zinc finger, MIZ-type containing 1, Alternative Gene Names: FLJ13541, hZIMP10, KIAA1224, MIZ, RAI17, RP11-519K18.1, Zimp10, Validated applications: ICC, IHC, Uniprot ID: Q9ULJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZMIZ1
Gene Description zinc finger, MIZ-type containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFT
Immunogen MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13541, hZIMP10, KIAA1224, MIZ, RAI17, RP11-519K18.1, Zimp10
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULJ6
HTS Code 3002150000
Gene ID 57178
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZMIZ1 Antibody 25ul

Anti-ZMIZ1 Antibody 25ul