MAPK11,p38-2
  • MAPK11,p38-2

Anti-MAPK11 Antibody 100ul

Ref: AN-HPA045069-100ul
Anti-MAPK11

Información del producto

Polyclonal Antibody against Human MAPK11, Gene description: mitogen-activated protein kinase 11, Alternative Gene Names: p38-2, p38Beta, PRKM11, SAPK2, Validated applications: IHC, Uniprot ID: Q15759, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAPK11
Gene Description mitogen-activated protein kinase 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA
Immunogen DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p38-2, p38Beta, PRKM11, SAPK2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15759
HTS Code 3002150000
Gene ID 5600
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAPK11 Antibody 100ul

Anti-MAPK11 Antibody 100ul