THAP4,CGI-36
  • THAP4,CGI-36

Anti-THAP4 Antibody 100ul

Ref: AN-HPA044982-100ul
Anti-THAP4

Información del producto

Polyclonal Antibody against Human THAP4, Gene description: THAP domain containing 4, Alternative Gene Names: CGI-36, Validated applications: IHC, Uniprot ID: Q8WY91, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name THAP4
Gene Description THAP domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHS
Immunogen EPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-36
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WY91
HTS Code 3002150000
Gene ID 51078
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-THAP4 Antibody 100ul

Anti-THAP4 Antibody 100ul