LSM3,SMX4,USS2
  • LSM3,SMX4,USS2

Anti-LSM3 Antibody 25ul

Ref: AN-HPA044966-25ul
Anti-LSM3

Información del producto

Polyclonal Antibody against Human LSM3, Gene description: LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae), Alternative Gene Names: SMX4, USS2, YLR438C, Validated applications: ICC, IHC, Uniprot ID: P62310, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LSM3
Gene Description LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDG
Immunogen DDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SMX4, USS2, YLR438C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P62310
HTS Code 3002150000
Gene ID 27258
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LSM3 Antibody 25ul

Anti-LSM3 Antibody 25ul