LY86,dJ80N2.1,MD-1
  • LY86,dJ80N2.1,MD-1

Anti-LY86 Antibody 25ul

Ref: AN-HPA044895-25ul
Anti-LY86

Información del producto

Polyclonal Antibody against Human LY86, Gene description: lymphocyte antigen 86, Alternative Gene Names: dJ80N2.1, MD-1, Validated applications: IHC, Uniprot ID: O95711, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LY86
Gene Description lymphocyte antigen 86
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMC
Immunogen SVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ80N2.1, MD-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95711
HTS Code 3002150000
Gene ID 9450
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LY86 Antibody 25ul

Anti-LY86 Antibody 25ul