KDSR,DHSR,FVT1
  • KDSR,DHSR,FVT1

Anti-KDSR Antibody 25ul

Ref: AN-HPA044884-25ul
Anti-KDSR

Información del producto

Polyclonal Antibody against Human KDSR, Gene description: 3-ketodihydrosphingosine reductase, Alternative Gene Names: DHSR, FVT1, SDR35C1, Validated applications: IHC, Uniprot ID: Q06136, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KDSR
Gene Description 3-ketodihydrosphingosine reductase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYL
Immunogen GFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DHSR, FVT1, SDR35C1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q06136
HTS Code 3002150000
Gene ID 2531
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KDSR Antibody 25ul

Anti-KDSR Antibody 25ul