GSPT2,eRF3b,FLJ10441
  • GSPT2,eRF3b,FLJ10441

Anti-GSPT2 Antibody 25ul

Ref: AN-HPA044769-25ul
Anti-GSPT2

Información del producto

Polyclonal Antibody against Human GSPT2, Gene description: G1 to S phase transition 2, Alternative Gene Names: eRF3b, FLJ10441, Validated applications: ICC, IHC, WB, Uniprot ID: Q8IYD1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GSPT2
Gene Description G1 to S phase transition 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT
Immunogen TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eRF3b, FLJ10441
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IYD1
HTS Code 3002150000
Gene ID 23708
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GSPT2 Antibody 25ul

Anti-GSPT2 Antibody 25ul