SPI1,OF,PU.1,SFPI1
  • SPI1,OF,PU.1,SFPI1

Anti-SPI1 Antibody 25ul

Ref: AN-HPA044653-25ul
Anti-SPI1

Información del producto

Polyclonal Antibody against Human SPI1, Gene description: Spi-1 proto-oncogene, Alternative Gene Names: OF, PU.1, SFPI1, SPI-1, SPI-A, Validated applications: ICC, IHC, Uniprot ID: P17947, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPI1
Gene Description Spi-1 proto-oncogene
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence EDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEG
Immunogen EDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names OF, PU.1, SFPI1, SPI-1, SPI-A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P17947
HTS Code 3002150000
Gene ID 6688
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPI1 Antibody 25ul

Anti-SPI1 Antibody 25ul