ARL15,ARFRP2
  • ARL15,ARFRP2

Anti-ARL15 Antibody 100ul

Ref: AN-HPA044604-100ul
Anti-ARL15

Información del producto

Polyclonal Antibody against Human ARL15, Gene description: ADP-ribosylation factor-like 15, Alternative Gene Names: ARFRP2, FLJ20051, Validated applications: IHC, WB, Uniprot ID: Q9NXU5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARL15
Gene Description ADP-ribosylation factor-like 15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSED
Immunogen TSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARFRP2, FLJ20051
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXU5
HTS Code 3002150000
Gene ID 54622
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARL15 Antibody 100ul

Anti-ARL15 Antibody 100ul