CELF1,BRUNOL2
  • CELF1,BRUNOL2

Anti-CELF1 Antibody 25ul

Ref: AN-HPA044597-25ul
Anti-CELF1

Información del producto

Polyclonal Antibody against Human CELF1, Gene description: CUGBP, Elav-like family member 1, Alternative Gene Names: BRUNOL2, CUG-BP, CUGBP, CUGBP1, EDEN-BP, hNab50, NAB50, NAPOR, Validated applications: ICC, WB, Uniprot ID: Q92879, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CELF1
Gene Description CUGBP, Elav-like family member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAA
Immunogen KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRUNOL2, CUG-BP, CUGBP, CUGBP1, EDEN-BP, hNab50, NAB50, NAPOR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92879
HTS Code 3002150000
Gene ID 10658
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CELF1 Antibody 25ul

Anti-CELF1 Antibody 25ul