KIAA1324L,EIG121L
  • KIAA1324L,EIG121L

Anti-KIAA1324L Antibody 25ul

Ref: AN-HPA044527-25ul
Anti-KIAA1324L

Información del producto

Polyclonal Antibody against Human KIAA1324L, Gene description: KIAA1324-like, Alternative Gene Names: EIG121L, FLJ31340, Validated applications: IHC, WB, Uniprot ID: A8MWY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KIAA1324L
Gene Description KIAA1324-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence TLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHIIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGVASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPD
Immunogen TLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHIIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGVASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EIG121L, FLJ31340
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A8MWY0
HTS Code 3002150000
Gene ID 222223
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KIAA1324L Antibody 25ul

Anti-KIAA1324L Antibody 25ul