MRPL15,HSPC145
  • MRPL15,HSPC145

Anti-MRPL15 Antibody 100ul

Ref: AN-HPA044425-100ul
Anti-MRPL15

Información del producto

Polyclonal Antibody against Human MRPL15, Gene description: mitochondrial ribosomal protein L15, Alternative Gene Names: HSPC145, L15mt, MRP-L15, MRP-L7, RPML7, Validated applications: IHC, WB, Uniprot ID: Q9P015, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL15
Gene Description mitochondrial ribosomal protein L15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence LRGQPIPKRMLPPEELVPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDEN
Immunogen LRGQPIPKRMLPPEELVPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDEN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC145, L15mt, MRP-L15, MRP-L7, RPML7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P015
HTS Code 3002150000
Gene ID 29088
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL15 Antibody 100ul

Anti-MRPL15 Antibody 100ul