C8orf34,vest-1,VEST1
  • C8orf34,vest-1,VEST1

Anti-C8orf34 Antibody 25ul

Ref: AN-HPA044420-25ul
Anti-C8orf34

Información del producto

Polyclonal Antibody against Human C8orf34, Gene description: chromosome 8 open reading frame 34, Alternative Gene Names: vest-1, VEST1, Validated applications: IHC, Uniprot ID: Q49A92, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C8orf34
Gene Description chromosome 8 open reading frame 34
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRS
Immunogen LPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names vest-1, VEST1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q49A92
HTS Code 3002150000
Gene ID 116328
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C8orf34 Antibody 25ul

Anti-C8orf34 Antibody 25ul