SLC13A5,NACT
  • SLC13A5,NACT

Anti-SLC13A5 Antibody 100ul

Ref: AN-HPA044343-100ul
Anti-SLC13A5

Información del producto

Polyclonal Antibody against Human SLC13A5, Gene description: solute carrier family 13 (sodium-dependent citrate transporter), member 5, Alternative Gene Names: NACT, Validated applications: IHC, WB, Uniprot ID: Q86YT5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC13A5
Gene Description solute carrier family 13 (sodium-dependent citrate transporter), member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW
Immunogen SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NACT
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86YT5
HTS Code 3002150000
Gene ID 284111
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC13A5 Antibody 100ul

Anti-SLC13A5 Antibody 100ul