SART3,KIAA0156,p110
  • SART3,KIAA0156,p110

Anti-SART3 Antibody 25ul

Ref: AN-HPA044322-25ul
Anti-SART3

Información del producto

Polyclonal Antibody against Human SART3, Gene description: squamous cell carcinoma antigen recognized by T cells 3, Alternative Gene Names: KIAA0156, p110, RP11-13G14, TIP110, Validated applications: IHC, Uniprot ID: Q15020, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SART3
Gene Description squamous cell carcinoma antigen recognized by T cells 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIE
Immunogen PWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0156, p110, RP11-13G14, TIP110
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15020
HTS Code 3002150000
Gene ID 9733
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SART3 Antibody 25ul

Anti-SART3 Antibody 25ul