DUS4L,DUS4,PP35
  • DUS4L,DUS4,PP35

Anti-DUS4L Antibody 100ul

Ref: AN-HPA044301-100ul
Anti-DUS4L

Información del producto

Polyclonal Antibody against Human DUS4L, Gene description: dihydrouridine synthase 4-like (S. cerevisiae), Alternative Gene Names: DUS4, PP35, Validated applications: ICC, IHC, Uniprot ID: O95620, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DUS4L
Gene Description dihydrouridine synthase 4-like (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGD
Immunogen ELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DUS4, PP35
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95620
HTS Code 3002150000
Gene ID 11062
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DUS4L Antibody 100ul

Anti-DUS4L Antibody 100ul