SDR39U1,C14orf124
  • SDR39U1,C14orf124

Anti-SDR39U1 Antibody 100ul

Ref: AN-HPA044294-100ul
Anti-SDR39U1

Información del producto

Polyclonal Antibody against Human SDR39U1, Gene description: short chain dehydrogenase/reductase family 39U, member 1, Alternative Gene Names: C14orf124, HCDI, Validated applications: ICC, IHC, Uniprot ID: Q9NRG7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SDR39U1
Gene Description short chain dehydrogenase/reductase family 39U, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RLPGDSTRQVVVRSGVVLGRGGGAMGHMLLPFRLGLGGPIGSGHQFFPWIHIGDLAGILTHALEANHVHGVLNGVAPSSATNAEFAQTFGAALGRRAFIPLPSAVVQAVFGRQRAIMLLEGQKVIPQ
Immunogen RLPGDSTRQVVVRSGVVLGRGGGAMGHMLLPFRLGLGGPIGSGHQFFPWIHIGDLAGILTHALEANHVHGVLNGVAPSSATNAEFAQTFGAALGRRAFIPLPSAVVQAVFGRQRAIMLLEGQKVIPQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf124, HCDI
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRG7
HTS Code 3002150000
Gene ID 56948
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SDR39U1 Antibody 100ul

Anti-SDR39U1 Antibody 100ul