ATP6V0A2,a2,ATP6a2
  • ATP6V0A2,a2,ATP6a2

Anti-ATP6V0A2 Antibody 100ul

Ref: AN-HPA044279-100ul
Anti-ATP6V0A2

Información del producto

Polyclonal Antibody against Human ATP6V0A2, Gene description: ATPase, H+ transporting, lysosomal V0 subunit a2, Alternative Gene Names: a2, ATP6a2, ATP6N1D, J6B7, Stv1, TJ6, TJ6M, TJ6s, Vph1, Validated applications: IHC, Uniprot ID: Q9Y487, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ATP6V0A2
Gene Description ATPase, H+ transporting, lysosomal V0 subunit a2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EVKRCEELERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKNLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLINQGKVEAFE
Immunogen EVKRCEELERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKNLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLINQGKVEAFE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names a2, ATP6a2, ATP6N1D, J6B7, Stv1, TJ6, TJ6M, TJ6s, Vph1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y487
HTS Code 3002150000
Gene ID 23545
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ATP6V0A2 Antibody 100ul

Anti-ATP6V0A2 Antibody 100ul