EDC3,FLJ21128
  • EDC3,FLJ21128

Anti-EDC3 Antibody 25ul

Ref: AN-HPA044206-25ul
Anti-EDC3

Información del producto

Polyclonal Antibody against Human EDC3, Gene description: enhancer of mRNA decapping 3, Alternative Gene Names: FLJ21128, hYjeF_N2-15q23, LSM16, YJDC, YJEFN2, Validated applications: IHC, Uniprot ID: Q96F86, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EDC3
Gene Description enhancer of mRNA decapping 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPL
Immunogen LDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ21128, hYjeF_N2-15q23, LSM16, YJDC, YJEFN2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96F86
HTS Code 3002150000
Gene ID 80153
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EDC3 Antibody 25ul

Anti-EDC3 Antibody 25ul