TSPYL2,CDA1,CINAP
  • TSPYL2,CDA1,CINAP

Anti-TSPYL2 Antibody 25ul

Ref: AN-HPA044133-25ul
Anti-TSPYL2

Información del producto

Polyclonal Antibody against Human TSPYL2, Gene description: TSPY-like 2, Alternative Gene Names: CDA1, CINAP, CTCL, DENTT, HRIHFB2216, SE20-4, TSPX, Validated applications: IHC, Uniprot ID: Q9H2G4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSPYL2
Gene Description TSPY-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDD
Immunogen NPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CDA1, CINAP, CTCL, DENTT, HRIHFB2216, SE20-4, TSPX
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2G4
HTS Code 3002150000
Gene ID 64061
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSPYL2 Antibody 25ul

Anti-TSPYL2 Antibody 25ul