MOB4,2C4D,CGI-95
  • MOB4,2C4D,CGI-95

Anti-MOB4 Antibody 25ul

Ref: AN-HPA044125-25ul
Anti-MOB4

Información del producto

Polyclonal Antibody against Human MOB4, Gene description: MOB family member 4, phocein, Alternative Gene Names: 2C4D, CGI-95, DKFZP564M112, MOB3, MOBKL3, PHOCN, PREI3, Validated applications: IHC, Uniprot ID: Q9Y3A3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MOB4
Gene Description MOB family member 4, phocein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKES
Immunogen RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2C4D, CGI-95, DKFZP564M112, MOB3, MOBKL3, PHOCN, PREI3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3A3
HTS Code 3002150000
Gene ID 25843
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MOB4 Antibody 25ul

Anti-MOB4 Antibody 25ul