BPIFA2,bA49G10.1
  • BPIFA2,bA49G10.1

Anti-BPIFA2 Antibody 100ul

Ref: AN-HPA044006-100ul
Anti-BPIFA2

Información del producto

Polyclonal Antibody against Human BPIFA2, Gene description: BPI fold containing family A, member 2, Alternative Gene Names: bA49G10.1, C20orf70, PSP, SPLUNC2, Validated applications: IHC, Uniprot ID: Q96DR5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BPIFA2
Gene Description BPI fold containing family A, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQII
Immunogen VDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA49G10.1, C20orf70, PSP, SPLUNC2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96DR5
HTS Code 3002150000
Gene ID 140683
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BPIFA2 Antibody 100ul

Anti-BPIFA2 Antibody 100ul