VPS36,C13orf9
  • VPS36,C13orf9

Anti-VPS36 Antibody 25ul

Ref: AN-HPA043947-25ul
Anti-VPS36

Información del producto

Polyclonal Antibody against Human VPS36, Gene description: vacuolar protein sorting 36 homolog (S. cerevisiae), Alternative Gene Names: C13orf9, CGI-145, Eap45, Validated applications: IHC, WB, Uniprot ID: Q86VN1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VPS36
Gene Description vacuolar protein sorting 36 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence KDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACK
Immunogen KDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C13orf9, CGI-145, Eap45
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86VN1
HTS Code 3002150000
Gene ID 51028
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VPS36 Antibody 25ul

Anti-VPS36 Antibody 25ul