DOCK9,KIAA1058,ZIZ1
  • DOCK9,KIAA1058,ZIZ1

Anti-DOCK9 Antibody 25ul

Ref: AN-HPA043940-25ul
Anti-DOCK9

Información del producto

Polyclonal Antibody against Human DOCK9, Gene description: dedicator of cytokinesis 9, Alternative Gene Names: KIAA1058, ZIZ1, Validated applications: IHC, WB, Uniprot ID: Q9BZ29, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DOCK9
Gene Description dedicator of cytokinesis 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LQLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEV
Immunogen LQLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1058, ZIZ1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BZ29
HTS Code 3002150000
Gene ID 23348
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DOCK9 Antibody 25ul

Anti-DOCK9 Antibody 25ul