TRIML2,FLJ25801 View larger

Anti-TRIML2 Antibody 25ul

AN-HPA043838-25ul

New product

Anti-TRIML2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25ul
Gene Name TRIML2
Gene Description tripartite motif family-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence KMIESEYSMRLRLLNEECEQNLQRQQECISDLNLRETLLNQAIKLATELEEMFQEMLQRLGRVGRENMEKLK
Immunogen KMIESEYSMRLRLLNEECEQNLQRQQECISDLNLRETLLNQAIKLATELEEMFQEMLQRLGRVGRENMEKLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ25801, SPRYD6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N7C3
HTS Code 3002150000
Gene ID 205860
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC, IHC, WB
Conjugation Unconjugated

More info

Polyclonal Antibody against Human TRIML2, Gene description: tripartite motif family-like 2, Alternative Gene Names: FLJ25801, SPRYD6, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N7C3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image