View larger
Anti-PPP4C Antibody 25ul
AN-HPA043837-25ul
New product
Anti-PPP4C
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 25ul |
| Gene Name | PPP4C |
| Gene Description | protein phosphatase 4, catalytic subunit |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | IHC, WB, ICC |
| Sequence | MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCG |
| Immunogen | MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCG |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | PP4, PPX |
| Category | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | P60510 |
| HTS Code | 3002150000 |
| Gene ID | 5531 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | WB, IHC, ICC |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human PPP4C, Gene description: protein phosphatase 4, catalytic subunit, Alternative Gene Names: PP4, PPX, Validated applications: ICC, IHC, WB, Uniprot ID: P60510, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF