HBA1,HBA-T3
  • HBA1,HBA-T3

Anti-HBA1 Antibody 100ul

Ref: AN-HPA043780-100ul
Anti-HBA1

Información del producto

Polyclonal Antibody against Human HBA1, Gene description: hemoglobin, alpha 1, Alternative Gene Names: HBA-T3, Validated applications: IHC, WB, Uniprot ID: P69905, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HBA1
Gene Description hemoglobin, alpha 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF
Immunogen MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HBA-T3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P69905
HTS Code 3002150000
Gene ID 3039
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HBA1 Antibody 100ul

Anti-HBA1 Antibody 100ul