ENPP3,B10,CD203c
  • ENPP3,B10,CD203c

Anti-ENPP3 Antibody 100ul

Ref: AN-HPA043772-100ul
Anti-ENPP3

Información del producto

Polyclonal Antibody against Human ENPP3, Gene description: ectonucleotide pyrophosphatase/phosphodiesterase 3, Alternative Gene Names: B10, CD203c, gp130RB13-6, PD-IBETA, PDNP3, Validated applications: IHC, Uniprot ID: O14638, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ENPP3
Gene Description ectonucleotide pyrophosphatase/phosphodiesterase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN
Immunogen LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B10, CD203c, gp130RB13-6, PD-IBETA, PDNP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14638
HTS Code 3002150000
Gene ID 5169
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ENPP3 Antibody 100ul

Anti-ENPP3 Antibody 100ul