RPL5,L5,PPP1R135
  • RPL5,L5,PPP1R135

Anti-RPL5 Antibody 100ul

Ref: AN-HPA043717-100ul
Anti-RPL5

Información del producto

Polyclonal Antibody against Human RPL5, Gene description: ribosomal protein L5, Alternative Gene Names: L5, PPP1R135, Validated applications: IHC, WB, Uniprot ID: P46777, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPL5
Gene Description ribosomal protein L5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence RLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEV
Immunogen RLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names L5, PPP1R135
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P46777
HTS Code 3002150000
Gene ID 6125
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPL5 Antibody 100ul

Anti-RPL5 Antibody 100ul