B3GNT8,B3GALT7
  • B3GNT8,B3GALT7

Anti-B3GNT8 Antibody 100ul

Ref: AN-HPA043669-100ul
Anti-B3GNT8

Información del producto

Polyclonal Antibody against Human B3GNT8, Gene description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8, Alternative Gene Names: B3GALT7, beta3Gn-T8, BGALT15, Validated applications: IHC, Uniprot ID: Q7Z7M8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name B3GNT8
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TPANPEPTLPANLSTRLGQTIPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLP
Immunogen TPANPEPTLPANLSTRLGQTIPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B3GALT7, beta3Gn-T8, BGALT15
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7M8
HTS Code 3002150000
Gene ID 374907
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-B3GNT8 Antibody 100ul

Anti-B3GNT8 Antibody 100ul