SNX20,SLIC-1,SLIC1
  • SNX20,SLIC-1,SLIC1

Anti-SNX20 Antibody 100ul

Ref: AN-HPA043649-100ul
Anti-SNX20

Información del producto

Polyclonal Antibody against Human SNX20, Gene description: sorting nexin 20, Alternative Gene Names: SLIC-1, SLIC1, Validated applications: ICC, IHC, WB, Uniprot ID: Q7Z614, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNX20
Gene Description sorting nexin 20
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence PGCMGPITQCTARTQQEAPATGPDLLHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASAR
Immunogen PGCMGPITQCTARTQQEAPATGPDLLHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASAR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SLIC-1, SLIC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z614
HTS Code 3002150000
Gene ID 124460
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNX20 Antibody 100ul

Anti-SNX20 Antibody 100ul