LNPEP,CAP,P-LAP,PLAP
  • LNPEP,CAP,P-LAP,PLAP

Anti-LNPEP Antibody 25ul

Ref: AN-HPA043642-25ul
Anti-LNPEP

Información del producto

Polyclonal Antibody against Human LNPEP, Gene description: leucyl/cystinyl aminopeptidase, Alternative Gene Names: CAP, P-LAP, PLAP, Validated applications: IHC, Uniprot ID: Q9UIQ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LNPEP
Gene Description leucyl/cystinyl aminopeptidase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKL
Immunogen EALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAP, P-LAP, PLAP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UIQ6
HTS Code 3002150000
Gene ID 4012
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LNPEP Antibody 25ul

Anti-LNPEP Antibody 25ul