DENND2D,FLJ22457
  • DENND2D,FLJ22457

Anti-DENND2D Antibody 100ul

Ref: AN-HPA043630-100ul
Anti-DENND2D

Información del producto

Polyclonal Antibody against Human DENND2D, Gene description: DENN/MADD domain containing 2D, Alternative Gene Names: FLJ22457, RP5-1180E21.2, Validated applications: IHC, WB, Uniprot ID: Q9H6A0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DENND2D
Gene Description DENN/MADD domain containing 2D
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAI
Immunogen PPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22457, RP5-1180E21.2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H6A0
HTS Code 3002150000
Gene ID 79961
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DENND2D Antibody 100ul

Anti-DENND2D Antibody 100ul