RALGAPA2,AS250
  • RALGAPA2,AS250

Anti-RALGAPA2 Antibody 25ul

Ref: AN-HPA043622-25ul
Anti-RALGAPA2

Información del producto

Polyclonal Antibody against Human RALGAPA2, Gene description: Ral GTPase activating protein, alpha subunit 2 (catalytic), Alternative Gene Names: AS250, C20orf74, dJ1049G11.4, KIAA1272, RapGAPalpha2, Validated applications: IHC, Uniprot ID: Q2PPJ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RALGAPA2
Gene Description Ral GTPase activating protein, alpha subunit 2 (catalytic)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SPAELDLKDDLQQTQGKCRERQKSESTNSDTTLGCTNEAELSMGPWQTCEEDPELNTPTDVVADADARHWLQLSPTDA
Immunogen SPAELDLKDDLQQTQGKCRERQKSESTNSDTTLGCTNEAELSMGPWQTCEEDPELNTPTDVVADADARHWLQLSPTDA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AS250, C20orf74, dJ1049G11.4, KIAA1272, RapGAPalpha2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q2PPJ7
HTS Code 3002150000
Gene ID 57186
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RALGAPA2 Antibody 25ul

Anti-RALGAPA2 Antibody 25ul