RALY,HNRPCL2,P542
  • RALY,HNRPCL2,P542

Anti-RALY Antibody 25ul

Ref: AN-HPA043614-25ul
Anti-RALY

Información del producto

Polyclonal Antibody against Human RALY, Gene description: RALY heterogeneous nuclear ribonucleoprotein, Alternative Gene Names: HNRPCL2, P542, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UKM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RALY
Gene Description RALY heterogeneous nuclear ribonucleoprotein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIK
Immunogen RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HNRPCL2, P542
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKM9
HTS Code 3002150000
Gene ID 22913
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RALY Antibody 25ul

Anti-RALY Antibody 25ul