CLCN7,CLC-7,CLC7
  • CLCN7,CLC-7,CLC7

Anti-CLCN7 Antibody 100ul

Ref: AN-HPA043586-100ul
Anti-CLCN7

Información del producto

Polyclonal Antibody against Human CLCN7, Gene description: chloride channel, voltage-sensitive 7, Alternative Gene Names: CLC-7, CLC7, OPTA2, PPP1R63, Validated applications: ICC, IHC, Uniprot ID: P51798, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CLCN7
Gene Description chloride channel, voltage-sensitive 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVT
Immunogen LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLC-7, CLC7, OPTA2, PPP1R63
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51798
HTS Code 3002150000
Gene ID 1186
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLCN7 Antibody 100ul

Anti-CLCN7 Antibody 100ul