SAE1,AOS1,FLJ3091
  • SAE1,AOS1,FLJ3091

Anti-SAE1 Antibody 25ul

Ref: AN-HPA043552-25ul
Anti-SAE1

Información del producto

Polyclonal Antibody against Human SAE1, Gene description: SUMO1 activating enzyme subunit 1, Alternative Gene Names: AOS1, FLJ3091, Sua1, Validated applications: IHC, WB, Uniprot ID: Q9UBE0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SAE1
Gene Description SUMO1 activating enzyme subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRD
Immunogen KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AOS1, FLJ3091, Sua1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBE0
HTS Code 3002150000
Gene ID 10055
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SAE1 Antibody 25ul

Anti-SAE1 Antibody 25ul