CDKN2D,INK4D,p19
  • CDKN2D,INK4D,p19

Anti-CDKN2D Antibody 100ul

Ref: AN-HPA043546-100ul
Anti-CDKN2D

Información del producto

Polyclonal Antibody against Human CDKN2D, Gene description: cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), Alternative Gene Names: INK4D, p19, Validated applications: ICC, Uniprot ID: P55273, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDKN2D
Gene Description cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR
Immunogen FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names INK4D, p19
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55273
HTS Code 3002150000
Gene ID 1032
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CDKN2D Antibody 100ul

Anti-CDKN2D Antibody 100ul