CYP51A1,CP51,CYP51
  • CYP51A1,CP51,CYP51

Anti-CYP51A1 Antibody 100ul

Ref: AN-HPA043508-100ul
Anti-CYP51A1

Información del producto

Polyclonal Antibody against Human CYP51A1, Gene description: cytochrome P450, family 51, subfamily A, polypeptide 1, Alternative Gene Names: CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1, Validated applications: ICC, IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CYP51A1
Gene Description cytochrome P450, family 51, subfamily A, polypeptide 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence AIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKML
Immunogen AIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKML
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 1595
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CYP51A1 Antibody 100ul

Anti-CYP51A1 Antibody 100ul