NOSIP,CGI-25
  • NOSIP,CGI-25

Anti-NOSIP Antibody 25ul

Ref: AN-HPA043464-25ul
Anti-NOSIP

Información del producto

Polyclonal Antibody against Human NOSIP, Gene description: nitric oxide synthase interacting protein, Alternative Gene Names: CGI-25, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y314, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NOSIP
Gene Description nitric oxide synthase interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence RHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGT
Immunogen RHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-25
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y314
HTS Code 3002150000
Gene ID 51070
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NOSIP Antibody 25ul

Anti-NOSIP Antibody 25ul